PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr002239.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 345aa    MW: 39225.8 Da    PI: 6.6556
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr002239.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.47.6e-091452148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++++ +G g W          R++k+c++rw +yl
      Pbr002239.1 14 RGLWSPEEDEKLIRYITTHGYG-WL--------QRCGKSCRLRWINYL 52
                     788*****************99.94........49***********97 PP

2Myb_DNA-binding53.17.5e-1758102147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr+T+eE++l++ ++   G++ W+ Ia++++ gRt++++k++w+++
      Pbr002239.1  58 RGRFTPEEEKLIISLHGVVGNR-WAHIASHLP-GRTDNEIKNYWNSW 102
                      89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.388952IPR017930Myb domain
SuperFamilySSF466894.49E-251199IPR009057Homeodomain-like
SMARTSM007172.7E-51354IPR001005SANT/Myb domain
PfamPF002499.6E-81452IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-161559IPR009057Homeodomain-like
PROSITE profilePS5129425.71253107IPR017930Myb domain
SMARTSM007171.9E-1657105IPR001005SANT/Myb domain
PfamPF002491.8E-1558102IPR001005SANT/Myb domain
CDDcd001672.01E-1260103No hitNo description
Gene3DG3DSA:1.10.10.604.1E-2560107IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MGHHSCCNQQ KVKRGLWSPE EDEKLIRYIT THGYGWLQRC GKSCRLRWIN YLRPDIRRGR  60
FTPEEEKLII SLHGVVGNRW AHIASHLPGR TDNEIKNYWN SWIKKKIRKP STPSSATTIS  120
PPPSVDHHQH IIPQLGNYNN QLDFAHQDLS PTIKPQAQET LFSSTCPMFM FDTSTTANIE  180
AAPDSYNARG EIFQDMIVTT GLNSSEPWNL NQHQVQAFPP PVTMSFNTTS SSTNNITMNT  240
NYLPPLIENM DNMVPNVDHH HHHHHHQSCN NIDEEGNHDQ IALECLMQRQ ELNEWVVSQQ  300
QCSSFLFWDS VVDDQATVLV GQDHGIAHPT SSNAVQLSSF PPSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-25141077108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4302166e-54KF430216.1 Gossypium hirsutum MYB103 protein (MYB103) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009363397.10.0PREDICTED: transcription factor MYB21-like
TrEMBLM5WPP31e-173M5WPP3_PRUPE; Uncharacterized protein
STRINGVIT_02s0025g00320.t011e-128(Vitis vinifera)
STRINGGLYMA11G02400.11e-128(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41123358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.13e-83myb domain protein 103